Protein basic information
LiverAtlas Protein ID |
HuLPr30436 |
Uniprot ID |
|
Uniprot Acc |
Q7RTS3;Q9HC25; |
Protein name |
Pancreas transcription factor 1 subunit alpha |
Comment |
FUNCTION:Transcriptional activator. Binds to the E-box consensus sequence 5'-CANNTG-3'. Plays an important role in determining whether cells allocated to the pancreatic buds continue towards pancreatic organogenesis or revert back to duodenal fates. May be involved in the maintenance of exocrine pancreas-specific gene expression including ELA1 and amylase. Required for the formation of pancreatic acinar and ductal cells (By similarity). Plays an important role in cerebellar development.||SUBUNIT:Component of the pancreas transcription factor 1 complex (PTF1) which is composed of TCF3/p75, TCF12/p64 and PTF1A/p48. TCF3 is responsible for the nuclear import of the p48/p64 complex. Interacts with TCF3 and RBPSUH/RBP-Jkappa (By similarity).||SUBCELLULAR LOCATION:Nucleus (By similarity). Cytoplasm (By similarity). Note=In chronic pancreatitis associated with pancreas cancer preferentially accumulates in the cytoplasm of acinar/ductular complexes. In the cytoplasm loses its ability to form t |
Subcellular localization |
Nucleus(By similarity).Cytoplasm(By similarity). |
Gene name |
|
Protein sequence
|
MDAVLLEHFPGGLDAFPSSYFDEDDFFTDQSSRDPLEDGD ELLADEQAEVEFLSHQLHEYCYRDGACLLLQPAPPAAPL ALAPPSSGGLGEPDDGGGGGYCCETGAPPGGFPYSPGSP PSCLAYPCAGAAVLSPGARLRGLSGAAAAAARRRRRVRS EAELQQLRQAANVRERRRMQSINDAFEGLRSHIPTLPYE KRLSKVDTLRLAIGYINFLSELVQADLPLRGGGAGGCGG PGGGGRLGGDSPGSQAQKVIICHRGTRSPSPSDPDYGLP PLAGHSLSWTDEKQLKEQNIIRTAKVWTPEDPRKLNSKS SFNNIENEPPFEFVS |
Database cross reference |
RefSeq Protein accession:NP_835455
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Chinese Liver;Human Fetal Liver;Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0005737;C:cytoplasm;ISS:UniProtKB. GO:0005667;C:transcription factor complex;ISS:UniProtKB. |
GO-P |
GO:0031018;P:endocrine pancreas development;TAS:Reactome. GO:0031017;P:exocrine pancreas development;ISS:UniProtKB. GO:0006355;P:regulation of transcription, DNA-dependent;ISS:UniProtKB. GO:0009888;P:tissue development;IDA:UniProtKB. GO:0006351;P:trans |
Pathway
Pathway name |