Protein basic information
LiverAtlas Protein ID |
HuLPr30965 |
Uniprot ID |
|
Uniprot Acc |
Q0VDC5; |
Protein name |
FKBP1A protein |
Comment |
SIMILARITY:Belongs to the FKBP-type PPIase family. |
Gene name |
|
Protein sequence
|
MSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLK LE |
Database cross reference |
RefSeq Protein accession:NP_000792
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
French Liver;Human Liver Organelles; |
Ontology annotation
GO-F |
GO:0003755;F:peptidyl-prolyl cis-trans isomerase activity;IEA:UniProtKB-KW. |
GO-P |
GO:0006457;P:protein folding;IEA:UniProtKB-KW. |