Protein basic information
LiverAtlas Protein ID |
HuLPr31063 |
Uniprot ID |
|
Uniprot Acc |
Q12848; |
Protein name |
TAP1 |
Gene name |
|
Protein sequence
|
NIMFRVTEDTSTLSDSLSENLSLFLWYLVRGLCLLGIMLW GSVSLTMVTLITLPLLFLLPKKVGKWYQ |
Database cross reference |
RefSeq Protein accession:NP_000584
|
Ontology annotation
GO-C |
GO:0005887;C:integral to plasma membrane;TAS:ProtInc. GO:0005624;C:membrane fraction;TAS:ProtInc. |
GO-F |
GO:0005524;F:ATP binding;IEA:InterPro. GO:0042626;F:ATPase activity, coupled to transmembrane movement of substances;TAS:ProtInc. GO:0015197;F:peptide transporter activity;TAS:ProtInc. |
GO-P |
GO:0006952;P:defense response;TAS:ProtInc. |