Protein basic information
| LiverAtlas Protein ID |
HuLPr31170 |
|
Uniprot ID |
|
|
Uniprot Acc |
Q14552; |
|
Protein name |
Haptoglobin |
|
Comment |
SIMILARITY:Belongs to the peptidase S1 family. |
|
Gene name |
|
|
Protein sequence
|
STCPKWKAPKSPVGVQPILNEHTFCVGMSKYQEDTCYGDA GSAFAVHDLEEDTWYAAGILSFDKSCAVAEYGVYVKVTS IQHWVQKTIAEN |
|
Database cross reference |
RefSeq Protein accession:NP_001119574
|
Liver relevance
| Liver sepcificity |
Yes/No |
Yes |
|
Evidence |
UniProtein |
|
|
Quality score |
|
|
|
HLPP validation |
Yes/No |
Yes |
|
Project name |
Human Liver Organelles; |
Ontology annotation
|
GO-F |
GO:0004252;F:serine-type endopeptidase activity;IEA:InterPro. |
|
GO-P |
GO:0006508;P:proteolysis;IEA:InterPro. |
