Protein basic information
LiverAtlas Protein ID |
HuLPr31431 |
Uniprot ID |
|
Uniprot Acc |
Q16868; |
Protein name |
CYP2E1 protein |
Comment |
SIMILARITY:Belongs to the cytochrome P450 family. |
Gene name |
|
Protein sequence
|
YFKAFSAGKRVCAGEGLARMELFLLLCAILQHFNLKPLVD PKDIDLSPIHIGFGCIPPRYKLCVIPRS |
Database cross reference |
RefSeq Protein accession:NP_000764
|
Ontology annotation
GO-F |
GO:0009055;F:electron carrier activity;IEA:InterPro. GO:0020037;F:heme binding;IEA:InterPro. GO:0004497;F:monooxygenase activity;IEA:UniProtKB-KW. GO:0016705;F:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecula |