Protein basic information
LiverAtlas Protein ID |
HuLPr33023 |
Uniprot ID |
|
Uniprot Acc |
Q4R1L4; |
Protein name |
Cytochrome c oxidase subunit 1 |
Comment |
FUNCTION:Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1- 3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B (By similarity).||CATALYTIC ACTIVITY:4 ferrocytochrome c + O(2) + 4 H(+) = 4 ferricytochrome c + 2 H(2)O.||PATHWAY:Energy metabolism; oxidative phosphorylation.||SUBCELLULAR LOCATION:Mitochondrion inner membrane; Multi-pass membrane protein (By similarity).||SIMILARITY:Belongs to the heme-copper respiratory oxidase family. |
Subcellular localization |
Mitochondrion inner membrane;Multi-pass membrane protein(By similarity). |
Gene name |
|
Protein sequence
|
YVVAHFHYVLSMGAVFAIMGGFIHWFPLFSGYTLDQTYAK IHFTIMFIGVNLTFFPQHFLGLSGMPRRYSDYPDAYTTW NILSSVGSFISLTAVMLMIFMIWEAFASKRKVLMVEEPS MNLEWLYGCPPPYHTFEEPVYMKS |
Database cross reference |
RefSeq Protein accession:YP_003024028
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Chinese Liver;Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0016021;C:integral to membrane;IEA:UniProtKB-KW. GO:0005743;C:mitochondrial inner membrane;IEA:UniProtKB-SubCell. GO:0070469;C:respiratory chain;IEA:UniProtKB-KW. |
GO-F |
GO:0004129;F:cytochrome-c oxidase activity;IEA:EC. GO:0009055;F:electron carrier activity;IEA:InterPro. GO:0020037;F:heme binding;IEA:InterPro. |
GO-P |
GO:0009060;P:aerobic respiration;IEA:InterPro. GO:0022900;P:electron transport chain;IEA:UniProtKB-KW. |