Protein basic information
LiverAtlas Protein ID |
HuLPr33542 |
Uniprot ID |
|
Uniprot Acc |
Q53GA5; |
Protein name |
Cellular tumor antigen p53 |
Comment |
FUNCTION:Acts as a tumor suppressor in many tumor types; induces growth arrest or apoptosis depending on the physiological circumstances and cell type. Involved in cell cycle regulation as a trans-activator that acts to negatively regulate cell division by controlling a set of genes required for this process. One of the activated genes is an inhibitor of cyclin-dependent kinases. Apoptosis induction seems to be mediated either by stimulation of BAX and FAS antigen expression, or by repression of Bcl-2 expression (By similarity).||COFACTOR:Binds 1 zinc ion per subunit (By similarity).||SUBUNIT:Binds DNA as a homotetramer (By similarity).||SUBCELLULAR LOCATION:Cytoplasm. Nucleus (By similarity).||SIMILARITY:Belongs to the p53 family. |
Subcellular localization |
Cytoplasm.Nucleus(By similarity). |
Gene name |
|
Protein sequence
|
YMCNSSCMGGMNGRPILTIITLEDSSGNLLGRNSFEVRVC ACPGRDRRTEEENLRKKGEPHHELPPGSTKRALPNNTSS SPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDA QAGKEPGGSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD |
Database cross reference |
RefSeq Protein accession:NP_000537
|
Ontology annotation
GO-C |
GO:0005737;C:cytoplasm;IEA:UniProtKB-SubCell. GO:0005634;C:nucleus;IEA:UniProtKB-SubCell. |
GO-F |
GO:0046872;F:metal ion binding;IEA:UniProtKB-KW. GO:0010843;F:promoter binding;IEA:InterPro. GO:0003700;F:sequence-specific DNA binding transcription factor activity;IEA:InterPro. |
GO-P |
GO:0006915;P:apoptosis;IEA:UniProtKB-KW. GO:0007049;P:cell cycle;IEA:UniProtKB-KW. GO:0051262;P:protein tetramerization;IEA:InterPro. GO:0006355;P:regulation of transcription, DNA-dependent;IEA:UniProtKB-KW. |
Pathway
Pathway name |