Protein basic information
LiverAtlas Protein ID |
HuLPr34093 |
Uniprot ID |
|
Uniprot Acc |
Q549M5; |
Protein name |
NADH dehydrogenase [ubiquinone] 1 subunit C2 |
Comment |
FUNCTION:Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).||SUBCELLULAR LOCATION:Mitochondrion inner membrane (By similarity).||SIMILARITY:Belongs to the complex I NDUFC2 subunit family. |
Subcellular localization |
Mitochondrion inner membrane(By similarity). |
Gene name |
NADH dehydrogenase (ubiquinone) 1, subcomplex unknown, 2, 14.5kDa |
Protein sequence
|
MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCS GLIDNLIRRRPIATAGLHRQLLYITAFFFAGYYLVKRED YLYAVRDREMFGYMKLHPEDFPEEDKKTYGEIFEKFHPIR |
Database cross reference |
RefSeq Protein accession:NP_001190983
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Chinese Liver;French Liver;Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0005743;C:mitochondrial inner membrane;IEA:UniProtKB-SubCell. GO:0070469;C:respiratory chain;IEA:UniProtKB-KW. |
GO-F |
GO:0008137;F:NADH dehydrogenase (ubiquinone) activity;IEA:InterPro. |
GO-P |
GO:0006120;P:mitochondrial electron transport, NADH to ubiquinone;IEA:InterPro. GO:0006810;P:transport;IEA:UniProtKB-KW. |