Protein basic information
LiverAtlas Protein ID |
HuLPr34210 |
Uniprot ID |
|
Uniprot Acc |
Q58I19; |
Protein name |
Na+/K+ transporting ATPase beta 2 polypeptide |
Comment |
SIMILARITY:Belongs to the X(+)/potassium ATPases subunit beta family. |
Gene name |
|
Protein sequence
|
RFMGRTGTSWAFILLFYLVFYGFLTAMFTLTMWVMLQTVS DHTPKYQDRLATPGLMIRPKTENLDVIVNVSDTESWDQH VQKLNKFLEPYNDSIQA |
Database cross reference |
RefSeq Protein accession:NP_001669
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Human Fetal Liver; |
Ontology annotation
GO-C |
GO:0016020;C:membrane;IEA:InterPro. |
GO-F |
GO:0005391;F:sodium:potassium-exchanging ATPase activity;IEA:InterPro. |
GO-P |
GO:0006754;P:ATP biosynthetic process;IEA:InterPro. |