Protein basic information
LiverAtlas Protein ID |
HuLPr35867 |
Uniprot ID |
|
Uniprot Acc |
Q5T3E5; |
Protein name |
Integrin beta |
Comment |
SUBCELLULAR LOCATION:Membrane; Single-pass type I membrane protein (By similarity).||SIMILARITY:Belongs to the integrin beta chain family. |
Subcellular localization |
Membrane;Single-pass type I membrane protein(By similarity). |
Gene name |
integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12) |
Protein sequence
|
MNLQPIFWIGLISSVCCVFAQTDENRCLKANAKSCGECIQ AGPNCGWCTNSTFLQEGMPTSARCDDLEALKKKGCPPDD IENPRGSKDI |
Database cross reference |
RefSeq Protein accession:NP_002202
|
Ontology annotation
GO-F |
GO:0004872;F:receptor activity;IEA:UniProtKB-KW. |
GO-P |
GO:0007229;P:integrin-mediated signaling pathway;IEA:UniProtKB-KW. |