Protein basic information
LiverAtlas Protein ID |
HuLPr36154 |
Uniprot ID |
|
Uniprot Acc |
Q5TEC6; |
Protein name |
Histone H3 |
Comment |
SUBUNIT:The nucleosome is a histone octamer containing two molecules each of H2A, H2B, H3 and H4 assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. The octamer wraps approximately 147 bp of DNA (By similarity).||SIMILARITY:Belongs to the histone H3 family. |
Gene name |
|
Protein sequence
|
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPH RYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQEF KTDLRFQSSAVMALQEAREAYLVGLFEDTNLCAIHAKRV TIMPKDIQLVSRIRGERA |
Database cross reference |
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Chinese Liver;French Liver;Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0000786;C:nucleosome;IEA:UniProtKB-KW. GO:0005634;C:nucleus;IEA:UniProtKB-KW. |
GO-F |
GO:0003677;F:DNA binding;IEA:UniProtKB-KW. |
GO-P |
GO:0006334;P:nucleosome assembly;IEA:InterPro. |