Protein basic information
LiverAtlas Protein ID |
HuLPr36526 |
Uniprot ID |
|
Uniprot Acc |
Q5W0X3; |
Protein name |
FK506 binding protein 1A, 12kDa |
Comment |
SIMILARITY:Belongs to the FKBP-type PPIase family. |
Gene name |
|
Protein sequence
|
MPVSVSSGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNK PFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYG ATGHPGIIPPHATLVFDVELLKLE |
Database cross reference |
RefSeq Protein accession:NP_000792
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
French Liver;Human Liver Organelles; |
Ontology annotation
GO-F |
GO:0003755;F:peptidyl-prolyl cis-trans isomerase activity;IEA:UniProtKB-KW. |
GO-P |
GO:0006457;P:protein folding;IEA:UniProtKB-KW. |