Protein basic information
LiverAtlas Protein ID |
HuLPr37407 |
Uniprot ID |
|
Uniprot Acc |
Q6GZ69; |
Protein name |
Constitutive androstane receptor SV21 |
Comment |
SIMILARITY:Belongs to the nuclear hormone receptor family.||SIMILARITY:Contains 1 nuclear receptor DNA-binding domain. |
Gene name |
|
Protein sequence
|
MASREDELRNCVVCGDQATGYHFNALTCEGCKGFFRRTVS KSIGPTCPFAGSCEVSKTQRRHCPACRLQKCLDAGMRKD TSSSSVHPSPALAHPGPCAASGHTLRRHQHFHGTASHQVY |
Database cross reference |
RefSeq Protein accession:NP_001070937
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Chinese Liver; |
Ontology annotation
GO-C |
GO:0005634;C:nucleus;IEA:UniProtKB-KW. |
GO-F |
GO:0004872;F:receptor activity;IEA:UniProtKB-KW. GO:0043565;F:sequence-specific DNA binding;IEA:InterPro. GO:0003700;F:sequence-specific DNA binding transcription factor activity;IEA:InterPro. GO:0008270;F:zinc ion binding;IEA:InterPro. |