Protein basic information
LiverAtlas Protein ID |
HuLPr37875 |
Uniprot ID |
|
Uniprot Acc |
Q6MZI0; |
Protein name |
Putative uncharacterized protein DKFZp686H02120 |
Comment |
DOMAIN:A pair of annexin repeats may form one binding site for calcium and phospholipid (By similarity).||SIMILARITY:Belongs to the annexin family.||SIMILARITY:Contains 2 annexin repeats. |
Gene name |
|
Protein sequence
|
VFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRNKS AYFAEKLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRAH FKRLYGKSLYSFIKGDTSGDYRKVLLVLCGGDD |
Database cross reference |
RefSeq Protein accession:NP_001144
|
Ontology annotation
GO-F |
GO:0005509;F:calcium ion binding;IEA:InterPro. GO:0005544;F:calcium-dependent phospholipid binding;IEA:UniProtKB-KW. |