Protein basic information
LiverAtlas Protein ID |
HuLPr38126 |
Uniprot ID |
|
Uniprot Acc |
Q6P2S0; |
Protein name |
SRP9 protein |
Gene name |
|
Protein sequence
|
MPQYQTWEEFSRAAEKLYLADPMKARVVLKYRHSDGNLCV KVTDDLVDH |
Database cross reference |
RefSeq Protein accession:NP_003124
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
French Liver; |
Ontology annotation
GO-C |
GO:0048500;C:signal recognition particle;IEA:InterPro. |
GO-F |
GO:0008312;F:7S RNA binding;IEA:InterPro. |
GO-P |
GO:0045900;P:negative regulation of translational elongation;IEA:InterPro. GO:0006614;P:SRP-dependent cotranslational protein targeting to membrane;IEA:InterPro. |