Protein basic information
LiverAtlas Protein ID |
HuLPr38674 |
Uniprot ID |
|
Uniprot Acc |
Q6WIG7; |
Protein name |
MHC class II antigen |
Gene name |
|
Protein sequence
|
ECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAVTEL GRPDEEYWNSQKDILEDERAAVDTYCRHNYGVVESFTV |
Database cross reference |
RefSeq Protein accession:NP_002115
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0016021;C:integral to membrane;IEA:UniProtKB-KW. GO:0042613;C:MHC class II protein complex;IEA:UniProtKB-KW. |
GO-P |
GO:0002504;P:antigen processing and presentation of peptide or polysaccharide antigen via MHC class II;IEA:UniProtKB-KW. GO:0006955;P:immune response;IEA:InterPro. |