Protein basic information
LiverAtlas Protein ID |
HuLPr39312 |
Uniprot ID |
|
Uniprot Acc |
Q767A3; |
Protein name |
Cytochrome P450 |
Gene name |
|
Protein sequence
|
TFILGCAPCNVICSIIFQKRFDYKDQQFLNLMEKLNEKIR IVSTPWMQ |
Database cross reference |
RefSeq Protein accession:NP_000760
|
Liver relevance
Liver sepcificity |
Yes/No |
Yes |
Evidence |
UniProtein |
|
Quality score |
|
|
HLPP validation |
Yes/No |
Yes |
Project name |
Chinese Liver;Human Liver Organelles; |
Ontology annotation
GO-F |
GO:0009055;F:electron carrier activity;IEA:InterPro. GO:0020037;F:heme binding;IEA:InterPro. GO:0016705;F:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen;IEA:InterPro. |