Protein basic information
| LiverAtlas Protein ID |
HuLPr39665 |
|
Uniprot ID |
|
|
Uniprot Acc |
Q7Z487; |
|
Protein name |
Transforming growth factor beta 1 |
|
Comment |
SIMILARITY:Belongs to the TGF-beta family. |
|
Gene name |
|
|
Protein sequence
|
STEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCP YIWSLDTQYSK |
|
Database cross reference |
RefSeq Protein accession:NP_000651
|
Liver relevance
|
HLPP validation |
Yes/No |
Yes |
|
Project name |
Chinese Liver;Human Liver Organelles; |
Ontology annotation
|
GO-F |
GO:0008083;F:growth factor activity;IEA:UniProtKB-KW. |
Pathway
| Pathway name | |
| Pathway name | |
| Pathway name |
