Protein basic information
LiverAtlas Protein ID |
HuLPr39665 |
Uniprot ID |
|
Uniprot Acc |
Q7Z487; |
Protein name |
Transforming growth factor beta 1 |
Comment |
SIMILARITY:Belongs to the TGF-beta family. |
Gene name |
|
Protein sequence
|
STEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCP YIWSLDTQYSK |
Database cross reference |
RefSeq Protein accession:NP_000651
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Chinese Liver;Human Liver Organelles; |
Ontology annotation
GO-F |
GO:0008083;F:growth factor activity;IEA:UniProtKB-KW. |
Pathway
Pathway name | |
Pathway name | |
Pathway name |