Protein basic information
LiverAtlas Protein ID |
HuLPr39806 |
Uniprot ID |
|
Uniprot Acc |
Q7Z6A2; |
Protein name |
Proliferating cell nuclear antigen |
Comment |
FUNCTION:This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand (By similarity).||SUBCELLULAR LOCATION:Nucleus (By similarity).||SIMILARITY:Belongs to the PCNA family. |
Subcellular localization |
Nucleus(By similarity). |
Gene name |
|
Protein sequence
|
MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSM DSSHVSLVQLTLRSEGFDTYRCDRNPAMGVNLT |
Database cross reference |
RefSeq Protein accession:NP_002583
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Chinese Liver;Human Fetal Liver;Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0005634;C:nucleus;IEA:UniProtKB-SubCell. GO:0043626;C:PCNA complex;IEA:InterPro. |
GO-F |
GO:0003677;F:DNA binding;IEA:UniProtKB-KW. GO:0030337;F:DNA polymerase processivity factor activity;IEA:InterPro. |
GO-P |
GO:0006260;P:DNA replication;IEA:UniProtKB-KW. GO:0006275;P:regulation of DNA replication;IEA:InterPro. |
Pathway
Pathway name |