Protein basic information
LiverAtlas Protein ID |
HuLPr39947 |
Uniprot ID |
|
Uniprot Acc |
Q86SQ8; |
Protein name |
Beta-defensin-1 |
Comment |
SIMILARITY:Belongs to the beta-defensin family. |
Gene name |
|
Protein sequence
|
GNFLTGLGHRSDHYNCISSGGQCLYSACPIFTKIQGTCYR GKAKCCK |
Database cross reference |
RefSeq Protein accession:NP_005209
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0005576;C:extracellular region;IEA:InterPro. |
GO-P |
GO:0042742;P:defense response to bacterium;IEA:UniProtKB-KW. |