Protein basic information
LiverAtlas Protein ID |
HuLPr42546 |
Uniprot ID |
|
Uniprot Acc |
Q9BXH2; |
Protein name |
STAT3 |
Gene name |
signal transducer and activator of transcription 3 (acute-phase response factor) |
Protein sequence
|
AAPYLKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNXG EGAEPSAGGQF |
Database cross reference |
RefSeq Protein accession:NP_003141
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
French Liver;Human Fetal Liver;Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0005634;C:nucleus;IEA:InterPro. |
GO-F |
GO:0003700;F:sequence-specific DNA binding transcription factor activity;IEA:InterPro. GO:0004871;F:signal transducer activity;IEA:InterPro. |