Protein basic information
LiverAtlas Protein ID |
HuLPr42564 |
Uniprot ID |
|
Uniprot Acc |
Q9BYK1; |
Protein name |
40S ribosomal protein S21 |
Comment |
SIMILARITY:Belongs to the ribosomal protein S21e family. |
Gene name |
|
Protein sequence
|
MQNDAGEFVDLYVPRKCSASNRIIGAKDHASIQMNVAEVD KVTGRFNGQFKTYAICGAIRRMVSVSLGFAHHFGTSWTL PCALECVMVPE |
Database cross reference |
RefSeq Protein accession:NP_001015
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
French Liver;Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0005840;C:ribosome;IEA:UniProtKB-KW. |
GO-F |
GO:0003735;F:structural constituent of ribosome;IEA:InterPro. |
GO-P |
GO:0006412;P:translation;IEA:InterPro. |