Protein basic information
LiverAtlas Protein ID |
HuLPr43451 |
Uniprot ID |
|
Uniprot Acc |
Q9TGM1; |
Protein name |
NADH-ubiquinone oxidoreductase chain 3 |
Comment |
FUNCTION:Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).||CATALYTIC ACTIVITY:NADH + ubiquinone = NAD(+) + ubiquinol.||SUBCELLULAR LOCATION:Mitochondrion membrane; Multi-pass membrane protein (By similarity).||SIMILARITY:Belongs to the complex I subunit 3 family. |
Subcellular localization |
Mitochondrion membrane;Multi-pass membrane protein(By similarity). |
Gene name |
|
Protein sequence
|
PWALQTTNLPLMVMSSLLLIIILALSLAYEWLQKGLDWAE |
Database cross reference |
RefSeq Protein accession:NP_001599
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0031966;C:mitochondrial membrane;IEA:UniProtKB-SubCell. GO:0070469;C:respiratory chain;IEA:UniProtKB-KW. |
GO-F |
GO:0008137;F:NADH dehydrogenase (ubiquinone) activity;IEA:EC. |
GO-P |
GO:0022900;P:electron transport chain;IEA:UniProtKB-KW. |