Protein basic information
LiverAtlas Protein ID |
HuLPr43941 |
Uniprot ID |
|
Uniprot Acc |
Q59GN2; |
Protein name |
Putative 60S ribosomal protein L39-like 5 |
Comment |
SIMILARITY:Belongs to the ribosomal protein L39e family.||CAUTION:Could be the product of a pseudogene.||SEQUENCE CAUTION:Sequence=BAD92314.1; Type=Erroneous initiation; |
Gene name |
|
Protein sequence
|
MSSHKTFKIKQFLAKKQKQNRPIPQWIRMKTGNKIRYNSK RRHWKRTKLGL |
Database cross reference |
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0005840;C:ribosome;IEA:UniProtKB-KW. |
GO-F |
GO:0003735;F:structural constituent of ribosome;IEA:InterPro. |
GO-P |
GO:0006412;P:translation;IEA:InterPro. |