Protein basic information
LiverAtlas Protein ID |
HuLPr44063 |
Uniprot ID |
|
Uniprot Acc |
Q99969; |
Protein name |
Retinoic acid receptor responder protein 2 |
Comment |
SUBCELLULAR LOCATION:Secreted (Potential).||TISSUE SPECIFICITY:Highly expressed in skin (basal and suprabasal layers of the epidermis, hair follicles and endothelial cells). Also found in pancreas, liver, spleen, prostate, ovary, small intestine and colon.||INDUCTION:Inhibited in psoriatic lesions. Activated by tazarotene in skin rafts and in the epidermis of psoriatic lesions. |
Subcellular localization |
Secreted(Potential). |
Gene name |
|
Protein sequence
|
MRRLLIPLALWLGAVGVGVAELTEAQRRGLQVALEEFHKH PPVQWAFQETSVESAVDTPFPAGIFVRLEFKLQQTSCRK RDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCP IETQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFS KALPRS |
Database cross reference |
RefSeq Protein accession:NP_002880
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0031012;C:extracellular matrix;IDA:DFLAT. |
GO-F |
GO:0005515;F:protein binding;IPI:UniProtKB. |
GO-P |
GO:0048566;P:embryonic digestive tract development;IMP:DFLAT. GO:0001701;P:in utero embryonic development;IEP:DFLAT. GO:0010759;P:positive regulation of macrophage chemotaxis;IMP:DFLAT. GO:0001523;P:retinoid metabolic process;IDA:UniProtKB. |