Protein basic information
LiverAtlas Protein ID |
HuLPr44654 |
Uniprot ID |
|
Uniprot Acc |
P34096; |
Protein name |
Ribonuclease 4 |
Comment |
FUNCTION:This RNase has marked specificity towards the 3' side of uridine nucleotides.||SUBCELLULAR LOCATION:Secreted.||SIMILARITY:Belongs to the pancreatic ribonuclease family. |
Subcellular localization |
Secreted. |
Gene name |
|
Related liver disease name |
|
Protein sequence
|
MALQRTHSLLLLLLLTLLGLGLVQPSYGQDGMYQRFLRQH VHPEETGGSDRYCNLMMQRRKMTLYHCKRFNTFIHEDIW NIRSICSTTNIQCKNGKMNCHEGVVKVTDCRDTGSSRAP NCRYRAIASTRRVVIACEGNPQVPVHFDG |
Database cross reference |
RefSeq Protein accession:NP_002928
|
Liver relevance
HCC significant Proteins |
Yes/No |
Yes |
Quality score |
|
Ontology annotation
GO-C |
GO:0005576;C:extracellular region;IEA:UniProtKB-SubCell. |
GO-F |
GO:0003676;F:nucleic acid binding;IEA:InterPro. GO:0004522;F:pancreatic ribonuclease activity;NAS:UniProtKB. |
GO-P |
GO:0006379;P:mRNA cleavage;NAS:UniProtKB. |