Protein basic information
LiverAtlas Protein ID |
HuLPr44874 |
Uniprot ID |
|
Uniprot Acc |
Q6UXX9;B3KVP0;Q4G0U4;Q8N6X6; |
Protein name |
R-spondin-2 |
Comment |
FUNCTION:Activator of the beta-catenin signaling cascade, leading to TCF-dependent gene activation. Acts both in the canonical Wnt/beta-catenin-dependent pathway, possibly via a direct interaction with Wnt proteins, and in a Wnt-independent beta catenin pathway through a receptor signaling pathway that may not use frizzled/LRP receptors. Probably also acts as a ligand for frizzled and LRP receptors (By similarity).||SUBUNIT:Interacts with WNT1. Binds heparin (By similarity).||SUBCELLULAR LOCATION:Secreted (By similarity).||ALTERNATIVE PRODUCTS:Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q6UXX9-1; Sequence=Displayed; Name=2; IsoId=Q6UXX9-2; Sequence=VSP 018321; Note=No experimental confirmation available; Name=3; IsoId=Q6UXX9-3; Sequence=VSP 018322, VSP 018323; Note=No experimental confirmation available;||DOMAIN:The FU repeat is required for activation and stabilization of beta-catenin (By similarity).||MISCELLANEOUS:Upon injection into mice, it induces rapid |
Subcellular localization |
Secreted(By similarity). |
Gene name |
|
Protein sequence
|
MQFRLFSFALIILNCMDYSHCQGNRWRRSKRASYVSNPIC KGCLSCSKDNGCSRCQQKLFFFLRREGMRQYGECLHSCP SGYYGHRAPDMNRCARCRIENCDSCFSKDFCTKCKVGFY LHRGRCFDECPDGFAPLEETMECVEGCEVGHWSEWGTCS RNNRTCGFKWGLETRTRQIVKKPVKDTILCPTIAESRRC KMTMRHCPGGKRTPKAKEKRNKKKKRKLIERAQEQHSVF LATDRANQ |
Database cross reference |
RefSeq Protein accession:NP_848660
|
Ontology annotation
GO-C |
GO:0005576;C:extracellular region;IEA:UniProtKB-SubCell. |
GO-F |
GO:0008201;F:heparin binding;IEA:UniProtKB-KW. |
GO-P |
GO:0016055;P:Wnt receptor signaling pathway;IEA:UniProtKB-KW. |