Protein basic information
LiverAtlas Protein ID |
HuLPr45062 |
Uniprot ID |
|
Uniprot Acc |
Q96DW6;Q9NWX2; |
Protein name |
Solute carrier family 25 member 38 |
Comment |
FUNCTION:Mitochondrial carrier required during erythropoiesis. Probably involved in the biosynthesis of heme, possibly by facilitating 5-aminolevulinate (ALA) production. May act by importing glycine into mitochondria or by exchanging glycine for ALA across the mitochondrial inner membrane.||SUBCELLULAR LOCATION:Mitochondrion inner membrane; Multi-pass membrane protein (By similarity).||TISSUE SPECIFICITY:Preferentially expressed in erythroid cells.||DISEASE:Defects in SLC25A38 are a cause of anemia sideroblastic pyridoxine-refractory autosomal recessive (PRARSA) [MIM:205950]. A form of sideroblastic anemia not responsive to pyridoxine. Sideroblastic anemia is characterized by anemia of varying severity, hypochromic peripheral erythrocytes, systemic iron overload secondary to chronic ineffective erythropoiesis, and the presence of bone marrow ringed sideroblasts. Sideroblasts are characterized by iron-loaded mitochondria clustered around the nucleus.||SIMILARITY:Belongs to the mitochon |
Subcellular localization |
Mitochondrion inner membrane;Multi-pass membrane protein(By similarity). |
Gene name |
|
Protein sequence
|
MIQNSRPSLLQPQDVGDTVETLMLHPVIKAFLCGSISGTC STLLFQPLDLLKTRLQTLQPSDHGSRRVGMLAVLLKVVR TESLLGLWKGMSPSIVRCVPGVGIYFGTLYSLKQYFLRG HPPTALESVMLGVGSRSVAGVCMSPITVIKTRYESGKYG YESIYAALRSIYHSEGHRGLFSGLTATLLRDAPFSGIYL MFYNQTKNIVPHDQVDATLIPITNFSCGIFAGILASLVT QPADVIKTHMQLYPLKFQWIGQAVTLIFKDYGLRGFFQG GIPRALRRTLMAAMAWTVYEEMMAKMGLKS |
Database cross reference |
RefSeq Protein accession:NP_060345
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
French Liver;Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0016021;C:integral to membrane;IEA:UniProtKB-KW. GO:0005743;C:mitochondrial inner membrane;IEA:UniProtKB-SubCell. |
GO-P |
GO:0030218;P:erythrocyte differentiation;IMP:UniProtKB. GO:0006783;P:heme biosynthetic process;TAS:UniProtKB. GO:0006810;P:transport;IEA:UniProtKB-KW. |