Protein basic information
LiverAtlas Protein ID |
HuLPr45238 |
Uniprot ID |
|
Uniprot Acc |
Q9NV23;Q5VUB6;Q9NUW1; |
Protein name |
S-acyl fatty acid synthase thioesterase, medium chain |
Comment |
FUNCTION:In fatty acid biosynthesis chain termination and release of the free fatty acid product is achieved by hydrolysis of the thio ester by a thioesterase I, a component of the fatty acid synthetase complex. The chain length of the released fatty acid is usually C16. However, in the mammary glands of non-ruminant mammals, and in the uropygial gland of certain waterfowl there exists a second thioesterase which releases medium-chain length fatty acids (C8 to C2) (By similarity).||CATALYTIC ACTIVITY:Oleoyl-[acyl-carrier-protein] + H(2)O = [acyl- carrier-protein] + oleate.||ALTERNATIVE PRODUCTS:Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9NV23-1; Sequence=Displayed; Name=2; IsoId=Q9NV23-2; Sequence=VSP 040022;||TISSUE SPECIFICITY:Isoform 2:Up-regulated in bone marrow-derived mononuclear cells of rheumatoid arthritis patients.||SIMILARITY:Belongs to the thioesterase family. |
Gene name |
|
Protein sequence
|
MERGDQPKRTRNENIFNCLYKNPEATFKLICFPWMGGGST HFAKWGQDTHDLLEVHSLRLPGRESRVEEPLENDISQLV DEVVCALQPVIQDKPFAFFGHSMGSYIAFRTALGLKENN QPEPLHLFLSSATPVHSKAWHRIPKDDELSEEQISHYLM EFGGTPKHFAEAKEFVKQCSPIIRADLNIVRSCTSNVPS KAVLSCDLTCFVGSEDIAKDMEAWKDVTSGNAKIYQLPG GHFYLLDPANEKLIKNYIIKCLEVSSISNF |
Database cross reference |
RefSeq Protein accession:NP_001034791
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
French Liver;Human Liver Organelles; |
Ontology annotation
GO-F |
GO:0016295;F:myristoyl-[acyl-carrier-protein] hydrolase activity;IEA:EC. GO:0004320;F:oleoyl-[acyl-carrier-protein] hydrolase activity;IEA:EC. GO:0016296;F:palmitoyl-[acyl-carrier-protein] hydrolase activity;IEA:EC. |
GO-P |
GO:0006633;P:fatty acid biosynthetic process;IEA:UniProtKB-KW. |
Pathway
Pathway name |