Protein basic information
LiverAtlas Protein ID |
HuLPr45410 |
Uniprot ID |
|
Uniprot Acc |
P62341;O95904;Q8IY80;Q9CZ45;Q9NZJ3; |
Protein name |
Selenoprotein T |
Comment |
TISSUE SPECIFICITY:Ubiquitous.||PTM:May contain a selenide-sulfide bond between Cys-46 and Sec- 49. This bond is speculated to serve as redox active pair (By similarity).||SIMILARITY:Belongs to the SelWTH family. SELT subfamily.||SEQUENCE CAUTION:Sequence=AAD20063.1; Type=Erroneous termination; Positions=49; Note=Translated as Sec; Sequence=AAF13696.1; Type=Frameshift; Positions=27; Sequence=AAQ88462.1; Type=Erroneous termination; Positions=49; Note=Translated as Sec; Sequence=AAQ88463.1; Type=Erroneous termination; Positions=49; Note=Translated as Sec; |
Gene name |
|
Protein sequence
|
MRLLLLLLVAASAMVRSEASANLGGVPSKRLKMQYATGPL LKFQICVSUGYRRVFEEYMRVISQRYPDIRIEGENYLPQ PIYRHIASFLSVFKLVLIGLIIVGKDPFAFFGMQAPSIW QWGQENKVYACMMVFFLSNMIENQCMSTGAFEITLNDVP VWSKLESGHLPSMQQLVQILDNEMKLNVHMDSIPHHRS |
Database cross reference |
RefSeq Protein accession:NP_057359
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Chinese Liver;Human Liver Organelles; |
Ontology annotation
GO-F |
GO:0008430;F:selenium binding;NAS:UniProtKB. |
GO-P |
GO:0045454;P:cell redox homeostasis;IEA:InterPro. GO:0001514;P:selenocysteine incorporation;NAS:UniProtKB. |