Protein basic information
LiverAtlas Protein ID |
HuLPr45501 |
Uniprot ID |
|
Uniprot Acc |
Q8IWL1;A4QPA7;B2RXI6;B2RXK9;P07714;Q14DV3;Q5RIR8;Q5RIR9; |
Protein name |
Pulmonary surfactant-associated protein A2 |
Comment |
FUNCTION:In presence of calcium ions, it binds to surfactant phospholipids and contributes to lower the surface tension at the air-liquid interface in the alveoli of the mammalian lung and is essential for normal respiration.||SUBUNIT:Oligomeric complex of 6 set of homotrimers.||SUBCELLULAR LOCATION:Secreted, extracellular space, extracellular matrix. Secreted, extracellular space, surface film.||POLYMORPHISM:At least 6 alleles of SFTPA2 are known:1A, 1A(0), 1A(1), 1A(2), 1A(3) and 1A(4). The sequence shown is that of allele 1A(0).||DISEASE:Defects in SFTPA2 are a cause of pulmonary fibrosis idiopathic (IPF) [MIM:178500]. Pulmonary fibrosis is a lung disease characterized by shortness of breath, radiographically evident diffuse pulmonary infiltrates, and varying degrees of inflammation and fibrosis on biopsy. It results in acute lung injury with subsequent scarring and endstage lung disease.||MISCELLANEOUS:Pulmonary surfactant consists of 90% lipid and 10% protein. There are 4 surfacta |
Subcellular localization |
Secreted, extracellular space, extracellular matrix.Secreted, extracellular space, surface film. |
Gene name |
|
Protein sequence
|
MWLCPLALNLILMAASGAACEVKDVCVGSPGIPGTPGSHG LPGRDGRDGVKGDPGPPGPMGPPGETPCPPGNNGLPGAP GVPGERGEKGEAGERGPPGLPAHLDEELQATLHDFRHQI LQTRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACAR AGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPG DFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWND RNCLYSRLTICEF |
Database cross reference |
RefSeq Protein accession:NP_001092138
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Chinese Liver; |
Ontology annotation
GO-C |
GO:0005581;C:collagen;IEA:UniProtKB-KW. GO:0005615;C:extracellular space;IEA:UniProtKB-SubCell. |
GO-F |
GO:0005529;F:sugar binding;IEA:UniProtKB-KW. |
GO-P |
GO:0034329;P:cell junction assembly;TAS:Reactome. GO:0007585;P:respiratory gaseous exchange;IEA:UniProtKB-KW. |
Pathway
Pathway name |