Protein basic information
LiverAtlas Protein ID |
HuLPr45848 |
Uniprot ID |
|
Uniprot Acc |
O43761;B2R9S0; |
Protein name |
Synaptogyrin-3 |
Comment |
FUNCTION:Involved in the positive regulation of dopamine transporter activity. Probably facilitates the physical and functional interactions of the transporter with the dopamine vesicular storage system, allowing a more efficient loading of the vesicles with extracellular dopamine after release (By similarity).||SUBUNIT:Interacts (via N-terminus) with SLC6A3 (via N-terminus) (By similarity).||SUBCELLULAR LOCATION:Membrane; Multi-pass membrane protein. Cytoplasmic vesicle, secretory vesicle, synaptic vesicle (By similarity). Cell junction, synapse. Note=Found at the neuromuscular synapses (By similarity).||TISSUE SPECIFICITY:Expressed in brain and placenta.||SIMILARITY:Belongs to the synaptogyrin family.||SIMILARITY:Contains 1 MARVEL domain. |
Subcellular localization |
Membrane;Multi-pass membrane protein.Cytoplasmic vesicle, secretory vesicle, synaptic vesicle(By similarity).Cell junction, synapse. |
Gene name |
|
Protein sequence
|
MEGASFGAGRAGAALDPVSFARRPQTLLRVASWVFSIAVF GPIVNEGYVNTDSGPELRCVFNGNAGACRFGVALGLGAF LACAAFLLLDVRFQQISSVRDRRRAVLLDLGFSGLWSFL WFVGFCFLTNQWQRTAPGPATTQAGDAARAAIAFSFFSI LSWVALTVKALQRFRLGTDMSLFATEQLSTGASQAYPGY PVGSGVEGTETYQSPPFTETLDTSPKGYQVPAY |
Database cross reference |
RefSeq Protein accession:NP_004200
|
Ontology annotation
GO-C |
GO:0030054;C:cell junction;IEA:UniProtKB-KW. GO:0005887;C:integral to plasma membrane;TAS:ProtInc. GO:0008021;C:synaptic vesicle;ISS:UniProtKB. |
GO-P |
GO:0032411;P:positive regulation of transporter activity;ISS:UniProtKB. |
Pathway
Pathway name |