Protein basic information
LiverAtlas Protein ID |
HuLPr46385 |
Uniprot ID |
|
Uniprot Acc |
Q8WUJ0;Q99850; |
Protein name |
Serine/threonine/tyrosine-interacting protein |
Comment |
FUNCTION:Probable pseudophosphatase. Contains a Gly residue instead of a conserved Cys residue in the dsPTPase catalytic loop which renders it catalytically inactive as a phosphatase. The binding pocket is however sufficiently preserved to bind phosphorylated substrates, and maybe protect them from phosphatases. Seems to play a role in spermiogenesis (By similarity).||SUBUNIT:Interacts with CARHSP1/Crhsp-24 (By similarity).||SIMILARITY:Belongs to the protein-tyrosine phosphatase family. Non-receptor class subfamily.||SIMILARITY:Contains 1 tyrosine-protein phosphatase domain. |
Gene name |
|
Protein sequence
|
MEDVKLEFPSLPQCKEDAEEWTYPMRREMQEILPGLFLGP YSSAMKSKLPVLQKHGITHIICIRQNIEANFIKPNFQQL FRYLVLDIADNPVENIIRFFPMTKEFIDGSLQMGGKVLV HGNAGISRSAAFVIAYIMETFGMKYRDAFAYVQERRFCI NPNAGFVHQLQEYEAIYLAKLTIQMMSPLQIERSLSVHS GTTGSLKRTHEEEDDFGTMQVATAQNG |
Database cross reference |
RefSeq Protein accession:NP_001124173
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0005737;C:cytoplasm;ISS:RefGenome. |
GO-F |
GO:0008138;F:protein tyrosine/serine/threonine phosphatase activity;IEA:InterPro. |
GO-P |
GO:0006470;P:protein dephosphorylation;IEA:InterPro. GO:0007283;P:spermatogenesis;ISS:RefGenome. |