Protein basic information
| LiverAtlas Protein ID |
HuLPr47180 |
|
Uniprot ID |
|
|
Uniprot Acc |
Q6UW68; |
|
Protein name |
Transmembrane protein 205 |
|
Comment |
FUNCTION:In cancer cells, plays a role in resistance to the chemotherapeutic agent cisplatin.||SUBCELLULAR LOCATION:Membrane; Multi-pass membrane protein. Note=Located on cell surface microvilli. In cancer cells, transition in subcellular location from cell surface to intracellular regions correlates the progression of cisplatin resistance.||TISSUE SPECIFICITY:Widely expressed with highest levels in pancreas, followed by adrenal gland, thyroid, liver, mammary gland, prostate, kidney, and retina; lowest levels in skeletal muscle. Overexpressed in cisplatin-resistant cancer cells (at protein level).||SIMILARITY:Belongs to the TMEM205 family. |
|
Subcellular localization |
Membrane;Multi-pass membrane protein. |
|
Gene name |
|
|
Protein sequence
|
MEEGGNLGGLIKMVHLLVLSGAWGMQMWVTFVSGFLLFRS LPRHTFGLVQSKLFPFYFHISMGCAFINLCILASQHAWA QLTFWEASQLYLLFLSLTLATVNARWLEPRTTAAMWALQ TVEKERGLGGEVPGSHQGPDPYRQLREKDPKYSALRQNF FRYHGLSSLCNLGCVLSNGLCLAGLALEIRSL |
|
Database cross reference |
RefSeq Protein accession:NP_001138888
|
Liver relevance
|
HLPP validation |
Yes/No |
Yes |
|
Project name |
Chinese Liver;French Liver;Human Fetal Liver;Human Liver Organelles; |
Ontology annotation
| GO-C |
GO:0016021;C:integral to membrane;IEA:UniProtKB-KW. |
Post-translational modification
| LiverAtlas Protein ID |
MOD type1 |
Position1 |
Residue1 |
Source name1 |
source ID1 |
Source method |
HLPP validation1 (Yes/no) |
Quality score |
|
HuLPr47180 |
ACETYLATION |
149 |
K |
PhosphoSitePlus |
HTP |
N |
 
|
