Protein basic information
LiverAtlas Protein ID |
HuLPr47301 |
Uniprot ID |
|
Uniprot Acc |
Q9BUB7;Q9NWY5; |
Protein name |
Transmembrane protein 70, mitochondrial |
Comment |
FUNCTION:Involved in biogenesis of mitochondrial ATP synthase.||SUBCELLULAR LOCATION:Mitochondrion inner membrane; Multi-pass membrane protein.||ALTERNATIVE PRODUCTS:Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9BUB7-1; Sequence=Displayed; Name=2; IsoId=Q9BUB7-2; Sequence=VSP 020759; Note=No experimental confirmation available;||DISEASE:Defects in TMEM70 are a cause of mitochondrial encephalocardiomyopathy neonatal due to ATP synthase deficiency (MT-ATPSD) [MIM:604273]; also known as ATPase deficiency. A mitochondrial disorder with heterogeneous clinical manifestations including dysmorphic features, psychomotor retardation, hypotonia, growth retardation, cardiomyopathy, enlarged liver, hypoplastic kidneys and elevated lactate levels in urine, plasma and cerebrospinal fluid.||SIMILARITY:Belongs to the TMEM70 family. |
Subcellular localization |
Mitochondrion inner membrane;Multi-pass membrane protein. |
Gene name |
|
Protein sequence
|
MLFLALGSPWAVELPLCGRRTALCAAAALRGPRASVSRAS SSSGPSGPVAGWSTGPSGAARLLRRPGRAQIPVYWEGYV RFLNTPSDKSEDGRLIYTGNMARAVFGVKCFSYSTSLIG LTFLPYIFTQNNAISESVPLPIQIIFYGIMGSFTVITPV LLHFITKGYVIRLYHEATTDTYKAITYNAMLAETSTVFH QNDVKIPDAKHVFTTFYAKTKSLLVNPVLFPNREDYIHL MGYDKEEFILYMEETSEEKRHKDDK |
Database cross reference |
RefSeq Protein accession:NP_001035703
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Chinese Liver;Human Liver Organelles;French Liver; |
Ontology annotation
GO-C |
GO:0032592;C:integral to mitochondrial membrane;IDA:UniProtKB. GO:0005743;C:mitochondrial inner membrane;IEA:UniProtKB-SubCell. |
GO-P |
GO:0033615;P:mitochondrial proton-transporting ATP synthase complex assembly;IMP:UniProtKB. |