Protein basic information
LiverAtlas Protein ID |
HuLPr47318 |
Uniprot ID |
|
Uniprot Acc |
Q5BJF2;B4DS02;Q07823; |
Protein name |
Transmembrane protein 97 |
Comment |
FUNCTION:Plays a role as a regulator of cellular cholesterol homeostasis.||SUBUNIT:Interacts with NPC1.||SUBCELLULAR LOCATION:Nucleus membrane. Rough endoplasmic reticulum. Cell membrane. Lysosome. Membrane; Multi-pass membrane protein (Potential). Note=Localized in sterol-depleted cells at cell membrane and in lysosomes.||TISSUE SPECIFICITY:Widely expressed in normal tissues. Expressed in pancreatic, renal, breast, colon, ovarian surface epithelial (OSE) cells and meningioma cancers. Expressed in ovarian cancer; expression is reduced relative to OSE cells.||INDUCTION:Up-regulated in ovarian surface epithelial (OSE) cells with progesterone.||SIMILARITY:Belongs to the TMEM97 family.||SEQUENCE CAUTION:Sequence=AAA16188.1; Type=Frameshift; Positions=5; |
Subcellular localization |
Nucleus membrane.Rough endoplasmic reticulum.Cell membrane.Lysosome.Membrane;Multi-pass membrane protein(Potential). |
Gene name |
|
Protein sequence
|
MGAPATRRCVEWLLGLYFLSHIPITLFMDLQAVLPRELYP VEFRNLLKWYAKEFKDPLLQEPPAWFKSFLFCELVFQLP FFPIATYAFLKGSCKWIRTPAIIYSVHTMTTLIPILSTF LFEDFSKASGFKGQRPETLHERLTLVSVYAPYLLIPFIL LIFMLRSPYYKYEEKRKKK |
Database cross reference |
RefSeq Protein accession:NP_055388
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Chinese Liver;Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0016021;C:integral to membrane;IEA:UniProtKB-KW. GO:0005764;C:lysosome;IDA:UniProtKB. GO:0031965;C:nuclear membrane;IDA:UniProtKB. GO:0005886;C:plasma membrane;IDA:UniProtKB. GO:0005791;C:rough endoplasmic reticulum;IDA:UniProtKB. |
GO-F |
GO:0005515;F:protein binding;IPI:UniProtKB. |
GO-P |
GO:0042632;P:cholesterol homeostasis;IDA:UniProtKB. GO:0001558;P:regulation of cell growth;NAS:UniProtKB. |