Protein basic information
| LiverAtlas Protein ID |
HuLPr47417 |
|
Uniprot ID |
|
|
Uniprot Acc |
Q8N4H5;B2DG07; |
|
Protein name |
Mitochondrial import receptor subunit TOM5 homolog |
|
Comment |
SUBUNIT:Forms part of the preprotein translocase complex of the outer mitochondrial membrane (TOM complex) which consists of at least 7 different proteins (TOMM5, TOMM6, TOMM7, TOMM20, TOMM22, TOMM40 and TOMM70).||SUBCELLULAR LOCATION:Mitochondrion outer membrane; Single-pass membrane protein.||SIMILARITY:Belongs to the Tom5 family. |
|
Subcellular localization |
Mitochondrion outer membrane;Single-pass membrane protein. |
|
Gene name |
translocase of outer mitochondrial membrane 5 homolog (yeast) |
|
Protein sequence
|
MFRIEGLAPKLDPEEMKRKMREDVISSIRNFLIYVALLRV TPFILKKLDSI |
|
Database cross reference |
RefSeq Protein accession:NP_001001790
|
Ontology annotation
| GO-C |
GO:0016021;C:integral to membrane;IEA:UniProtKB-KW. GO:0005742;C:mitochondrial outer membrane translocase complex;IDA:UniProtKB. |
|
GO-P |
GO:0006626;P:protein targeting to mitochondrion;IC:UniProtKB. |
Post-translational modification
| LiverAtlas Protein ID |
MOD type1 |
Position1 |
Residue1 |
Source name1 |
source ID1 |
Source method |
HLPP validation1 (Yes/no) |
Quality score |
|
HuLPr47417 |
ACETYLATION |
46 |
K |
PhosphoSitePlus |
HTP |
N |
 
|
