Protein basic information
LiverAtlas Protein ID |
HuLPr47455 |
Uniprot ID |
|
Uniprot Acc |
Q9UL33;B2R4M9;Q6ZTA7;Q9NZZ4; |
Protein name |
Trafficking protein particle complex subunit 2-like protein |
Comment |
FUNCTION:May play a role in vesicular transport from endoplasmic reticulum to Golgi.||SUBUNIT:Part of the multisubunit TRAPP (transport protein particle) complex. Interacts with the heterodimer TRAPPC3- TRAPPC6A. Interacts with TRAPPC2, TRAPPC3, TRAPPC4 and TRAPPC6A.||SUBCELLULAR LOCATION:Cytoplasm, perinuclear region. Endoplasmic reticulum. Golgi apparatus.||ALTERNATIVE PRODUCTS:Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9UL33-1; Sequence=Displayed; Name=2; IsoId=Q9UL33-2; Sequence=VSP 026641;||TISSUE SPECIFICITY:Expressed in testis, liver, bladder, lung, spleen and brain, several cell lines and primary chondrocytes cell line.||SIMILARITY:Belongs to the TRAPP small subunits family. Sedlin subfamily.||SEQUENCE CAUTION:Sequence=BAC86686.1; Type=Miscellaneous discrepancy; Note=Intron retention; |
Subcellular localization |
Cytoplasm, perinuclear region.Endoplasmic reticulum.Golgi apparatus. |
Gene name |
|
Protein sequence
|
MAVCIAVIAKENYPLYIRSTPTENELKFHYMVHTSLDVVD EKISAMGKALVDQRELYLGLLYPTEDYKVYGYVTNSKVK FVMVVDSSNTALRDNEIRSMFRKLHNSYTDVMCNPFYNP GDRIQSSRAFDNMVTSMMIQVC |
Database cross reference |
RefSeq Protein accession:NP_057293
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Chinese Liver; |
Ontology annotation
GO-C |
GO:0005783;C:endoplasmic reticulum;IEA:UniProtKB-SubCell. GO:0005794;C:Golgi apparatus;IEA:UniProtKB-SubCell. GO:0048471;C:perinuclear region of cytoplasm;IEA:UniProtKB-SubCell. |
GO-P |
GO:0006888;P:ER to Golgi vesicle-mediated transport;IEA:InterPro. |