Protein basic information
| LiverAtlas Protein ID |
HuLPr47605 |
|
Uniprot ID |
|
|
Uniprot Acc |
O43715;B2R4Z7;Q5RKS5;Q6LCA7; |
|
Protein name |
TP53-regulated inhibitor of apoptosis 1 |
|
Comment |
FUNCTION:Mediates cell survival by inhibiting activation of caspase-9 which prevents induction of apoptosis.||SUBUNIT:Interacts with APAF1 and HSP70.||SUBCELLULAR LOCATION:Cytoplasm, perinuclear region.||INDUCTION:In p53/TP53-dependent manner in response to low levels of DNA damage. Not induced when DNA damage is severe.||SIMILARITY:Belongs to the TRIAP1/MDM35 family.||SEQUENCE CAUTION:Sequence=AAR00584.1; Type=Erroneous initiation; |
|
Subcellular localization |
Cytoplasm, perinuclear region. |
|
Gene name |
|
|
Protein sequence
|
MNSVGEACTDMKREYDQCFNRWFAEKFLKGDSSGDPCTDL FKRYQQCVQKAIKEKEIPIEGLEFMGHGKEKPENSS |
|
Database cross reference |
RefSeq Protein accession:NP_057483
|
Liver relevance
|
HLPP validation |
Yes/No |
Yes |
|
Project name |
Chinese Liver; |
Ontology annotation
| GO-C |
GO:0005739;C:mitochondrion;IDA:HGNC. GO:0048471;C:perinuclear region of cytoplasm;IEA:UniProtKB-SubCell. |
|
GO-F |
GO:0043027;F:caspase inhibitor activity;IDA:HGNC. GO:0005515;F:protein binding;IPI:HGNC. |
|
GO-P |
GO:0006916;P:anti-apoptosis;IMP:HGNC. GO:0006915;P:apoptosis;IEA:UniProtKB-KW. GO:0006977;P:DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest;TAS:HGNC. |
Pathway
| Pathway name | |
| Pathway name |
