Protein basic information
| LiverAtlas Protein ID |
HuLPr47701 |
|
Uniprot ID |
|
|
Uniprot Acc |
Q969D9;Q8IW99; |
|
Protein name |
Thymic stromal lymphopoietin |
|
Comment |
FUNCTION:Cytokine that induces the release of T cell-attracting chemokines from monocytes and, in particular, enhances the maturation of CD11c(+) dendritic cells. Can induce allergic inflammation by directly activating mast cells.||SUBUNIT:Interacts with a receptor composed of CRLF2 and IL7R.||INTERACTION:P04156:PRNP; NbExp=1; IntAct=EBI-2602335, EBI-977302;||SUBCELLULAR LOCATION:Secreted.||TISSUE SPECIFICITY:Expressed in a number of tissues including heart, liver and prostate.||INDUCTION:Released by primary epithelial cells in response to certain microbial products, physical injury, or inflammatory cytokines. |
|
Subcellular localization |
Secreted. |
|
Gene name |
|
|
Protein sequence
|
MFPFALLYVLSVSFRKIFILQLVGLVLTYDFTNCDFEKIK AAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEI QSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQI NATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ |
|
Database cross reference |
RefSeq Protein accession:NP_149024
|
Liver relevance
|
HLPP validation |
Yes/No |
Yes |
|
Project name |
Chinese Liver; |
Ontology annotation
| GO-C |
GO:0005615;C:extracellular space;IEA:UniProtKB-KW. |
|
GO-F |
GO:0005125;F:cytokine activity;IEA:UniProtKB-KW. |
Pathway
| Pathway name |
