Home - LiverAtlas

Choose one of the five choices you want to search:

Gene, Transcriptome, Protein, Pathway or Disease.

Protein basic information

LiverAtlas Protein ID	HuLPr47938
Uniprot ID	UBB_HUMAN
Uniprot Acc	P0CG47;P02248;P02249;P02250;P62988;Q29120;Q6LBL4;Q6LDU5;Q8WYN8;Q91887;Q91888;Q9BWD6;Q9BX98;Q9UEF2;Q9UEG1;Q9UEK8;Q9UPK7;
Protein name	Polyubiquitin-B
Comment	FUNCTION:Ubiquitin exists either covalently attached to another protein, or free (unanchored). When covalently bound, it is conjugated to target proteins via an isopeptide bond either as a monomer (monoubiquitin), a polymer linked via different Lys residues of the ubiquitin (polyubiquitin chains) or a linear polymer linked via the initiator Met of the ubiquitin (linear polyubiquitin chains). Polyubiquitin chains, when attached to a target protein, have different functions depending on the Lys residue of the ubiquitin that is linked:Lys-6-linked may be involved in DNA repair; Lys-11-linked is involved in ERAD (endoplasmic reticulum-associated degradation) and in cell-cycle regulation; Lys-29-linked is involved in lysosomal degradation; Lys-33-linked is involved in kinase modification; Lys-48-linked is involved in protein degradation via the proteasome; Lys-63-linked is involved in endocytosis, DNA-damage responses as well as in signaling processes leading to activation of the transcript
Subcellular localization	Ubiquitin:Cytoplasm(By similarity).Nucleus(By similarity).
Gene name	ubiquitin B
Related liver disease name	Hepatocellular carcinoma
Protein sequence	MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQ QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQI FVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQR LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFV KTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC
Database cross reference	RefSeq Protein accession:NP_061828 RefSeq Protein gi:11024714

Liver relevance

HCC significant Proteins	Yes/No	Yes
HCC significant Proteins	Quality score

Ontology annotation

GO-C	GO:0005829;C:cytosol;EXP:Reactome. GO:0030666;C:endocytic vesicle membrane;TAS:Reactome. GO:0010008;C:endosome membrane;EXP:Reactome. GO:0005654;C:nucleoplasm;EXP:Reactome. GO:0005886;C:plasma membrane;TAS:Reactome.
GO-F	GO:0005515;F:protein binding;IPI:IntAct.
GO-P	GO:0000187;P:activation of MAPK activity;TAS:Reactome. GO:0031145;P:anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process;EXP:Reactome. GO:0006916;P:anti-apoptosis;EXP:Reactome. GO:0006915;P:apoptosis;EXP:Reactom

Post-translational modification

LiverAtlas Protein ID	MOD type1	Position1	Residue1	Source name1	source ID1	Source method	HLPP validation1 (Yes/no)	Quality score
HuLPr47938	PHOSPHORYLATION	12	T	PhosphoSitePlus	13302264	LTP	N
HuLPr47938	PHOSPHORYLATION	7	T	PhosphoSitePlus	13302267	LTP	N
HuLPr47938	PHOSPHORYLATION	12	T	PhosphoSitePlus	13302272	LTP	N
HuLPr47938	PHOSPHORYLATION	159	T	PhosphoSitePlus	13302274	LTP	N
HuLPr47938	PHOSPHORYLATION	164	T	PhosphoSitePlus	13302276	LTP	N
HuLPr47938	PHOSPHORYLATION	7	T	PhosphoSitePlus	13302278	LTP	N
HuLPr47938	PHOSPHORYLATION	83	T	PhosphoSitePlus	13302280	LTP	N
HuLPr47938	PHOSPHORYLATION	88	T	PhosphoSitePlus	13302282	LTP	N
HuLPr47938	ACETYLATION	6	K	PhosphoSitePlus	459084	LTP HTP	N
HuLPr47938	ACETYLATION	63	K	PhosphoSitePlus	459085	LTP	N
HuLPr47938	ACETYLATION	48	K	PhosphoSitePlus	459086	LTP HTP	N
HuLPr47938	ACETYLATION	33	K	PhosphoSitePlus	459087	LTP	N
HuLPr47938	ACETYLATION	11	K	PhosphoSitePlus	459088	LTP	N
HuLPr47938	ACETYLATION	29	K	PhosphoSitePlus	459089	LTP	N
HuLPr47938	ACETYLATION	27	K	PhosphoSitePlus	459090	LTP	N
HuLPr47938	UBIQUITINATION	27	K	PhosphoSitePlus	3931595	LTP HTP	N
HuLPr47938	PHOSPHORYLATION	59	Y	PhosphoSitePlus	14917327	LTP	N
HuLPr47938	PHOSPHORYLATION	135	Y	PhosphoSitePlus	14917329	HTP	N
HuLPr47938	PHOSPHORYLATION	211	Y	PhosphoSitePlus	14917331	HTP	N
HuLPr47938	ACETYLATION	6	K	PhosphoSitePlus	14320034	LTP	N
HuLPr47938	ACETYLATION	82	K	PhosphoSitePlus	14320036	HTP	N
HuLPr47938	ACETYLATION	158	K	PhosphoSitePlus	14320038	HTP	N
HuLPr47938	PHOSPHORYLATION	59	Y	PhosphoSitePlus	479209	LTP HTP	N
HuLPr47938	UBIQUITINATION	6	K	PhosphoSitePlus	486300	LTP HTP	N
HuLPr47938	UBIQUITINATION	11	K	PhosphoSitePlus	486301	LTP HTP	N
HuLPr47938	UBIQUITINATION	33	K	PhosphoSitePlus	486302	LTP HTP	N
HuLPr47938	UBIQUITINATION	48	K	PhosphoSitePlus	486303	LTP HTP	N
HuLPr47938	UBIQUITINATION	63	K	PhosphoSitePlus	486304	LTP HTP	N
HuLPr47938	ACETYLATION	124	K	PhosphoSitePlus	18546386	HTP	N
HuLPr47938	ACETYLATION	200	K	PhosphoSitePlus	18546388	HTP	N
HuLPr47938	ACETYLATION	48	K	PhosphoSitePlus	18546390	LTP HTP	N
HuLPr47938	UBIQUITINATION	29	K	PhosphoSitePlus	3135200	LTP	N
HuLPr47938	PHOSPHORYLATION	57	S	PhosphoSitePlus	448541	HTP	N
HuLPr47938	PHOSPHORYLATION	57	S	PhosphoSitePlus	12667106	LTP	N
HuLPr47938	PHOSPHORYLATION	133	S	PhosphoSitePlus	12667108	LTP	N
HuLPr47938	PHOSPHORYLATION	209	S	PhosphoSitePlus	12667110	LTP	N