Protein basic information
LiverAtlas Protein ID |
HuLPr48170 |
Uniprot ID |
|
Uniprot Acc |
O95399;Q5H8X7;Q6UXF6;Q9UKP7; |
Protein name |
Urotensin-2 |
Comment |
FUNCTION:Highly potent vasoconstrictor.||SUBCELLULAR LOCATION:Secreted.||ALTERNATIVE PRODUCTS:Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=O95399-1; Sequence=Displayed; Name=2; IsoId=O95399-2; Sequence=VSP 013638; Note=No experimental confirmation available;||TISSUE SPECIFICITY:Brain specific.||SIMILARITY:Belongs to the urotensin-2 family. |
Subcellular localization |
Secreted. |
Gene name |
|
Protein sequence
|
MYKLASCCLLFIGFLNPLLSLPLLDSREISFQLSAPHEDA RLTPEELERASLLQILPEMLGAERGDILRKADSSTNIFN PRGNLRKFQDFSGQDPNILLSHLLARIWKPYKKRETPDC FWKYCV |
Database cross reference |
RefSeq Protein accession:NP_006777
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Chinese Liver; |
Ontology annotation
GO-C |
GO:0005615;C:extracellular space;TAS:ProtInc. |
GO-F |
GO:0005179;F:hormone activity;TAS:ProtInc. |
GO-P |
GO:0006936;P:muscle contraction;TAS:ProtInc. GO:0008217;P:regulation of blood pressure;TAS:ProtInc. GO:0007268;P:synaptic transmission;TAS:ProtInc. |