Choose one of the five choices you want to search:

Gene, Transcriptome, Protein, Pathway or Disease. 

Protein basic information

LiverAtlas Protein ID

HuLPr48182

Uniprot ID

VA0E2_HUMAN

Uniprot Acc

Q8NHE4;A2T863;A2T8L7;Q6MZW1;Q75L47;Q8N7I8;

Protein name

V-type proton ATPase subunit e 2

Comment

FUNCTION:Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells (By similarity).||SUBUNIT:Composed of at least 10 subunits.||SUBCELLULAR LOCATION:Membrane; Multi-pass membrane protein (Potential).||ALTERNATIVE PRODUCTS:Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q8NHE4-1; Sequence=Displayed; Name=2; IsoId=Q8NHE4-2; Sequence=VSP 027104; Name=3; IsoId=Q8NHE4-3; Sequence=VSP 027105; Note=May be due to a competing donor splice site;||TISSUE SPECIFICITY:Isoform 1 is expressed at high levels in heart, brain and kidney and also detected in inner ear epithelium, vestibule, testis, epididymis and bladder. Isoform 2 is expressed in heart, kidney, placenta and pancreas. Isoform 2 is not detected in frontal cortex, but is prevalent in all other brain areas.||SIMILARITY:Belongs to the V-ATPase e subunit family.||SEQUENCE CAUTION:Sequence=AAQ96859.1; Type=Erroneous gene model prediction; Sequence=BAC05292.1; Type=Erroneous in

Subcellular localization

Membrane;Multi-pass membrane protein(Potential).

Gene name

ATPase, H+ transporting V0 subunit e2

Protein sequence

MTAHSFALPVIIFTTFWGLVGIAGPWFVPKGPNRGVIITM LVATAVCCYLFWLIAILAQLNPLFGPQLKNETIWYVRFL WE

Database cross reference

RefSeq Protein accession:NP_001094062
RefSeq Protein gi:154689796

Ontology annotation

GO-C

GO:0010008;C:endosome membrane;EXP:Reactome. GO:0016021;C:integral to membrane;NAS:UniProtKB. GO:0033179;C:proton-transporting V-type ATPase, V0 domain;IEA:InterPro.

GO-F

GO:0042625;F:ATPase activity, coupled to transmembrane movement of ions;ISS:UniProtKB. GO:0015078;F:hydrogen ion transmembrane transporter activity;IEA:InterPro.

GO-P

GO:0015991;P:ATP hydrolysis coupled proton transport;IEA:InterPro. GO:0016049;P:cell growth;IGI:UniProtKB. GO:0006879;P:cellular iron ion homeostasis;TAS:Reactome. GO:0008286;P:insulin receptor signaling pathway;TAS:Reactome. GO:0033572;P:transferrin t