Protein basic information
| LiverAtlas Protein ID |
HuLPr48308 |
|
Uniprot ID |
|
|
Uniprot Acc |
Q86VN1;A8K125;Q3ZCV7;Q5H9S1;Q5VXB6;Q9H8Z5;Q9Y3E3; |
|
Protein name |
Vacuolar protein-sorting-associated protein 36 |
|
Comment |
FUNCTION:Component of the ESCRT-II complex (endosomal sorting complex required for transport II), which is required for multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. The MVB pathway mediates delivery of transmembrane proteins into the lumen of the lysosome for degradation. The ESCRT-II complex is probably involved in the recruitment of the ESCRT-III complex. Its ability to bind ubiquitin probably plays a role in endosomal sorting of ubiquitinated cargo proteins by ESCRT complexes. The ESCRT-II complex may also play a role in transcription regulation, possibly via its interaction with ELL. Binds phosphoinosides such as PtdIns(3,4,5)P3.||SUBUNIT:Component of a complex at least composed of ELL, SNF8/EAP30, VPS25/EAP20 and VPS36/EAP45 (By similarity). Component of the endosomal sorting complex required for transport II (ESCRT- II), composed of SNF8, VPS36 and two copies of VPS25. Interacts with VPS25, SNF8, TSG101 and VPS36. Interacts (via GLUE d |
|
Subcellular localization |
Cytoplasm.Endosome.Late endosome.Membrane.Nucleus(Probable). |
|
Gene name |
|
|
Protein sequence
|
MDRFVWTSGLLEINETLVIQQRGVRIYDGEEKIKFDAGTL LLSTHRLIWRDQKNHECCMAILLSQIVFIEEQAAGIGKS AKIVVHLHPAPPNKEPGPFQSSKNSYIKLSFKEHGQIEF YRRLSEEMTQRRWENMPVSQSLQTNRGPQPGRIRAVGIV GIERKLEEKRKETDKNISEAFEDLSKLMIKAKEMVELSK SIANKIKDKQGDITEDETIRFKSYLLSMGIANPVTRETY GSGTQYHMQLAKQLAGILQVPLEERGGIMSLTEVYCLVN RARGMELLSPEDLVNACKMLEALKLPLRLRVFDSGVMVI ELQSHKEEEMVASALETVSEKGSLTSEEFAKLVGMSVLL AKERLLLAEKMGHLCRDDSVEGLRFYPNLFMTQS |
|
Database cross reference |
RefSeq Protein accession:NP_057159
|
Liver relevance
|
HLPP validation |
Yes/No |
Yes |
|
Project name |
Chinese Liver;French Liver;Human Liver Organelles; |
Ontology annotation
| GO-C |
GO:0005829;C:cytosol;EXP:Reactome. GO:0005770;C:late endosome;IEA:UniProtKB-SubCell. GO:0016020;C:membrane;IEA:UniProtKB-SubCell. GO:0005634;C:nucleus;IEA:UniProtKB-SubCell. |
|
GO-F |
GO:0008289;F:lipid binding;IEA:UniProtKB-KW. |
|
GO-P |
GO:0016044;P:cellular membrane organization;EXP:Reactome. GO:0016197;P:endosome transport;TAS:Reactome. GO:0015031;P:protein transport;IEA:UniProtKB-KW. GO:0006355;P:regulation of transcription, DNA-dependent;IEA:UniProtKB-KW. GO:0006351;P:transcriptio |
