Home - LiverAtlas

Choose one of the five choices you want to search:

Gene, Transcriptome, Protein, Pathway or Disease.

Protein basic information

LiverAtlas Protein ID	HuLPr48545
Uniprot ID	XRCC6_HUMAN
Uniprot Acc	P12956;Q6FG89;Q9UCQ2;Q9UCQ3;
Protein name	X-ray repair cross-complementing protein 6
Comment	FUNCTION:Single stranded DNA-dependent ATP-dependent helicase. Has a role in chromosome translocation. The DNA helicase II complex binds preferentially to fork-like ends of double-stranded DNA in a cell cycle-dependent manner. It works in the 3'-5' direction. Binding to DNA may be mediated by XRCC6. Involved in DNA non-homologous end joining (NHEJ) required for double-strand break repair and V(D)J recombination. The XRCC5/6 dimer acts as regulatory subunit of the DNA-dependent protein kinase complex DNA-PK by increasing the affinity of the catalytic subunit PRKDC to DNA by 100-fold. The XRCC5/6 dimer is probably involved in stabilizing broken DNA ends and bringing them together. The assembly of the DNA-PK complex to DNA ends is required for the NHEJ ligation step. Required for osteocalcin gene expression. Probably also acts as a 5'-deoxyribose-5-phosphate lyase (5'-dRP lyase), by catalyzing the beta-elimination of the 5' deoxyribose- 5-phosphate at an abasic site near double-strand bre
Subcellular localization	Nucleus.Chromosome.
Gene name	X-ray repair complementing defective repair in Chinese hamster cells 6
Related liver disease name	Hepatocellular carcinoma
Protein sequence	MSGWESYYKTEGDEEAEEEQEENLEASGDYKYSGRDSLIF LVDASKAMFESQSEDELTPFDMSIQCIQSVYISKIISSD RDLLAVVFYGTEKDKNSVNFKNIYVLQELDNPGAKRILE LDQFKGQQGQKRFQDMMGHGSDYSLSEVLWVCANLFSDV QFKMSHKRIMLFTNEDNPHGNDSAKASRARTKAGDLRDT GIFLDLMHLKKPGGFDISLFYRDIISIAEDEDLRVHFEE SSKLEDLLRKVRAKETRKRALSRLKLKLNKDIVISVGIY NLVQKALKPPPIKLYRETNEPVKTKTRTFNTSTGGLLLP SDTKRSQIYGSRQIILEKEETEELKRFDDPGLMLMGFKP LVLLKKHHYLRPSLFVYPEESLVIGSSTLFSALLIKCLE KEVAALCRYTPRRNIPPYFVALVPQEEELDDQKIQVTPP GFQLVFLPFADDKRKMPFTEKIMATPEQVGKMKAIVEKL RFTYRSDSFENPVLQQHFRNLEALALDLMEPEQAVDLTL PKVEAMNKRLGSLVDEFKELVYPPDYNPEGKVTKRKHDN EGSGSKRPKVEYSEEELKTHISKGTLGKFTVPMLKEACR AYGLKSGLKKQELLEALTKHFQD
Database cross reference	RefSeq Protein accession:NP_001460 RefSeq Protein gi:4503841

Liver relevance

HCC significant Proteins	Yes/No	Yes
HCC significant Proteins	Quality score
HLPP validation	Yes/No	Yes
HLPP validation	Project name	Chinese Liver;French Liver;Human Liver Organelles;

Ontology annotation

GO-C	GO:0005958;C:DNA-dependent protein kinase-DNA ligase 4 complex;IEA:InterPro. GO:0043564;C:Ku70:Ku80 complex;IDA:UniProtKB. GO:0005624;C:membrane fraction;TAS:ProtInc. GO:0000783;C:nuclear telomere cap complex;TAS:BHF-UCL. GO:0005667;C:transcription fac
GO-F	GO:0051575;F:5'-deoxyribose-5-phosphate lyase activity;IMP:UniProtKB. GO:0005524;F:ATP binding;IEA:UniProtKB-KW. GO:0004003;F:ATP-dependent DNA helicase activity;TAS:ProtInc. GO:0003690;F:double-stranded DNA binding;TAS:ProtInc. GO:0010843;F:promoter b
GO-P	GO:0006266;P:DNA ligation;TAS:ProtInc. GO:0006303;P:double-strand break repair via nonhomologous end joining;IMP:UniProtKB. GO:0019059;P:initiation of viral infection;EXP:Reactome. GO:0045892;P:negative regulation of transcription, DNA-dependent;IMP:Uni

Post-translational modification

LiverAtlas Protein ID	MOD type1	Position1	Residue1	Source name1	source ID1	Source method	HLPP validation1 (Yes/no)	Quality score
HuLPr48545	PHOSPHORYLATION	222	S	Phospho-ELM	6245	HTP	N
HuLPr48545	PHOSPHORYLATION	37	S	Phospho-ELM	3286	HTP	N
HuLPr48545	PHOSPHORYLATION	6	S	Phospho-ELM	8048	LTP	N
HuLPr48545	PHOSPHORYLATION	292	T	PhosphoSitePlus	14702941	LTP	N
HuLPr48545	ACETYLATION	282	K	PhosphoSitePlus	483055	LTP	N
HuLPr48545	PHOSPHORYLATION	306	S	PhosphoSitePlus	3180579	LTP	N
HuLPr48545	PHOSPHORYLATION	477	S	PhosphoSitePlus	3180585	LTP	N
HuLPr48545	PHOSPHORYLATION	6	S	PhosphoSitePlus	452070	LTP	N
HuLPr48545	PHOSPHORYLATION	550	S	PhosphoSitePlus	18011390	LTP	N
HuLPr48545	PHOSPHORYLATION	577	T	PhosphoSitePlus	18011393	LTP	N
HuLPr48545	PHOSPHORYLATION	51	S	PhosphoSitePlus	10211800	LTP	N
HuLPr48545	ACETYLATION	31	K	PhosphoSitePlus	11315878	HTP	N
HuLPr48545	PHOSPHORYLATION	455	T	PhosphoSitePlus	469188	LTP	N
HuLPr48545	PHOSPHORYLATION	27	S	PhosphoSitePlus	449267	HTP	N
HuLPr48545	PHOSPHORYLATION	588	Y	PhosphoSitePlus	462298	LTP	N
HuLPr48545	PHOSPHORYLATION	520	S	PhosphoSitePlus	4763166	LTP	N
HuLPr48545	PHOSPHORYLATION	530	Y	PhosphoSitePlus	463414	LTP	N
HuLPr48545	ACETYLATION	461	K	PhosphoSitePlus	474564	LTP	N
HuLPr48545	PHOSPHORYLATION	222	S	PhosphoSitePlus	457581	LTP	N
HuLPr48545	MONO-METHYLATION	207	K	PhosphoSitePlus	2586320	LTP	N
HuLPr48545	MONO-METHYLATION	92	K	PhosphoSitePlus	2586321	LTP	N
HuLPr48545	MONO-METHYLATION	114	K	PhosphoSitePlus	2586322	HTP	N
HuLPr48545	PHOSPHORYLATION	7	Y	PhosphoSitePlus	473691	LTP	N
HuLPr48545	PHOSPHORYLATION	8	Y	PhosphoSitePlus	473692	LTP	N
HuLPr48545	ACETYLATION	317	K	PhosphoSitePlus	458918	LTP HTP	N
HuLPr48545	ACETYLATION	331	K	PhosphoSitePlus	458919	LTP HTP	N
HuLPr48545	ACETYLATION	338	K	PhosphoSitePlus	458920	LTP HTP	N
HuLPr48545	ACETYLATION	539	K	PhosphoSitePlus	458921	LTP	N
HuLPr48545	ACETYLATION	542	K	PhosphoSitePlus	458922	LTP	N
HuLPr48545	ACETYLATION	544	K	PhosphoSitePlus	458923	LTP	N
HuLPr48545	ACETYLATION	553	K	PhosphoSitePlus	458924	LTP	N
HuLPr48545	ACETYLATION	556	K	PhosphoSitePlus	458925	LTP	N
HuLPr48545	ACETYLATION	468	K	PhosphoSitePlus	3649424	LTP	N

Pathway

Pathway name	Coregulation_of_Androgen_receptor_activity
Pathway name	BARD1_signaling_events
Pathway name	DNA-PK_pathway_in_nonhomologous_end_joining
Pathway name	Signaling_events_mediated_by_HDAC_Class_III
Pathway name	Regulation_of_Telomerase
Pathway name	TCR