Protein basic information
LiverAtlas Protein ID |
HuLPr48638 |
Uniprot ID |
|
Uniprot Acc |
O15498;Q53F01;Q6FGU9;Q6IB15; |
Protein name |
Synaptobrevin homolog YKT6 |
Comment |
FUNCTION:Vesicular soluble NSF attachment protein receptor (v- SNARE) mediating vesicle docking and fusion to a specific acceptor cellular compartment. Functions in endoplasmic reticulum to Golgi transport; as part of a SNARE complex composed of GOSR1, GOSR2 and STX5. Functions in early/recycling endosome to TGN transport; as part of a SNARE complex composed of BET1L, GOSR1 and STX5. Has a S-palmitoyl transferase activity.||SUBUNIT:Identified in 2 different SNARE complexes; the first one composed of GOSR1, GOSR2 and STX5 and the second one composed of BET1L, GOSR1 and STX5 (By similarity).||SUBCELLULAR LOCATION:Cytoplasm, cytosol. Cytoplasmic vesicle membrane; Lipid-anchor; Cytoplasmic side. Golgi apparatus membrane; Lipid-anchor; Cytoplasmic side. Note=Probably cycles through vesicles between Golgi and endosomes.||DOMAIN:The longin domain regulates palmitoylation and membrane targeting.||PTM:Palmitoylated; catalyzes its own palmitoylation. Palmitoylation is required for Golgi targetin |
Subcellular localization |
Cytoplasm, cytosol.Cytoplasmic vesicle membrane;Lipid-anchor;Cytoplasmic side.Golgi apparatus membrane;Lipid-anchor;Cytoplasmic side. |
Gene name |
|
Protein sequence
|
MKLYSLSVLYKGEAKVVLLKAAYDVSSFSFFQRSSVQEFM TFTSQLIVERSSKGTRASVKEQDYLCHVYVRNDSLAGVV IADNEYPSRVAFTLLEKVLDEFSKQVDRIDWPVGSPATI HYPALDGHLSRYQNPREADPMTKVQAELDETKIILHNTM ESLLERGEKLDDLVSKSEVLGTQSKAFYKTARKQNSCCAIM |
Database cross reference |
RefSeq Protein accession:NP_006546
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0030659;C:cytoplasmic vesicle membrane;IEA:UniProtKB-SubCell. GO:0005829;C:cytosol;IEA:UniProtKB-SubCell. GO:0005783;C:endoplasmic reticulum;IDA:HGNC. GO:0005768;C:endosome;IDA:HGNC. GO:0000139;C:Golgi membrane;IEA:UniProtKB-SubCell. GO:0005887;C:i |
GO-F |
GO:0019706;F:protein-cysteine S-palmitoleyltransferase activity;IDA:HGNC. GO:0005484;F:SNAP receptor activity;IDA:HGNC. |
GO-P |
GO:0006888;P:ER to Golgi vesicle-mediated transport;IDA:HGNC. GO:0015031;P:protein transport;IEA:UniProtKB-KW. GO:0042147;P:retrograde transport, endosome to Golgi;IDA:HGNC. GO:0006904;P:vesicle docking involved in exocytosis;IDA:HGNC. GO:0006903;P:ves |