Protein basic information
LiverAtlas Protein ID |
HuLPr48878 |
Uniprot ID |
|
Uniprot Acc |
Q9BQ24;A8K3A4;Q86T05;Q96LT1; |
Protein name |
Zinc finger FYVE domain-containing protein 21 |
Comment |
FUNCTION:Plays a role in cell adhesion, and thereby in cell motility, regulating microtubule-induced PTK2/FAK dephosphorylation, an event important for focal adhesion disassemblya, as well as integrin beta-1/ITGB1 cell surface expression.||SUBUNIT:Interacts with PTK2/FAK.||SUBCELLULAR LOCATION:Cell junction, focal adhesion. Cytoplasmic vesicle. Note=Within cytoplasmic vesicles, partially colocalizes with EEA1, an endosomal marker.||ALTERNATIVE PRODUCTS:Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9BQ24-1; Sequence=Displayed; Name=2; IsoId=Q9BQ24-2; Sequence=VSP 013794; Note=No experimental confirmation available;||SIMILARITY:Contains 1 FYVE-type zinc finger.||SEQUENCE CAUTION:Sequence=CAD62589.1; Type=Erroneous initiation; |
Subcellular localization |
Cell junction, focal adhesion.Cytoplasmic vesicle. |
Gene name |
|
Protein sequence
|
MSSEVSARRDAKKLVRSPSGLRMVPEHRAFGSPFGLEEPQ WVPDKECRRCMQCDAKFDFLTRKHHCRRCGKCFCDRCCS QKVPLRRMCFVDPVRQCAECALVSLKEAEFYDKQLKVLL SGATFLVTFGNSEKPETMTCRLSNNQRYLFLDGDSHYEI EIVHISTVQILTEGFPPGGGNARATGMFLQYTVPGTEGV TQLKLTVVEDVTVGRRQAVAWLVAMHKAAKLLYESRDQ |
Database cross reference |
RefSeq Protein accession:NP_001185882
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Human Fetal Liver;Chinese Liver;French Liver;Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0016023;C:cytoplasmic membrane-bounded vesicle;IEA:UniProtKB-SubCell. GO:0005925;C:focal adhesion;IEA:UniProtKB-SubCell. |
GO-F |
GO:0008270;F:zinc ion binding;IEA:InterPro. |