Protein basic information
LiverAtlas Protein ID |
HuLPr49225 |
Uniprot ID |
|
Uniprot Acc |
Q5JUW0;A8K0Y8;B3KU22;Q96EA3;Q9NXB1; |
Protein name |
Protein ZNF673 |
Comment |
ALTERNATIVE PRODUCTS:Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q5JUW0-1; Sequence=Displayed; Note=Gene prediction based on EST data; Name=2; IsoId=Q5JUW0-2; Sequence=VSP 018163; Name=3; IsoId=Q5JUW0-3; Sequence=VSP 018164, VSP 018165; Note=No experimental confirmation available;||TISSUE SPECIFICITY:Expressed in brain, ovary, testis, prostate, tonsil, heart, bone marrow, colon, breast and kidney.||SIMILARITY:Contains 1 KRAB domain.||CAUTION:Despite its name, it does not contain a canonical C2H2- type zinc-finger, seems to be a partial inverted duplication of ZNF674. |
Gene name |
|
Protein sequence
|
MAMSQESLTFKDVFVDFTLEEWQQLDSAQKNLYRDVMLEN YSHLVSVGYLVAKPDVIFRLGPGEESWMADGGTPVRTCA GEDRPEVWQVDEQIDHYKESQDKLPWQAAFIGKETLKDE SGQESRTCRKSIYLSTEFDSVRQRLPKYYSWEKAFKTSF KLSWSKWKLCKKER |
Database cross reference |
RefSeq Protein accession:NP_001123370
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Chinese Liver; |
Ontology annotation
GO-C |
GO:0005622;C:intracellular;IEA:InterPro. |
GO-F |
GO:0003676;F:nucleic acid binding;IEA:InterPro. |
GO-P |
GO:0006355;P:regulation of transcription, DNA-dependent;IEA:InterPro. |
Post-translational modification
LiverAtlas Protein ID |
MOD type1 |
Position1 |
Residue1 |
Source name1 |
source ID1 |
Source method |
HLPP validation1 (Yes/no) |
Quality score |
HuLPr49225 |
PHOSPHORYLATION |
9 |
T |
PhosphoSitePlus |
LTP |
N |