Protein basic information
LiverAtlas Protein ID |
HuLPr49304 |
Uniprot ID |
|
Uniprot Acc |
Q6ZRF7; |
Protein name |
Putative zinc finger protein 818 |
Comment |
FUNCTION:May be involved in transcriptional regulation.||SUBCELLULAR LOCATION:Nucleus (Probable).||SIMILARITY:Belongs to the krueppel C2H2-type zinc-finger protein family.||SIMILARITY:Contains 2 C2H2-type zinc fingers.||CAUTION:Could be the product of a pseudogene. |
Subcellular localization |
Nucleus(Probable). |
Gene name |
|
Protein sequence
|
MLERNLTSMMSVEEPLPRPLTSLYIRLSILERNHMNMTYM AKSSVKIHISKVIIGFVLKRSLTNVCGKVLSQNSHLVNH QRIHTGEKSYRCHECGKAFTQGSRFINHQIVHTGENFPN VLNVARLLRMALNSGLTK |
Database cross reference |
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Chinese Liver;French Liver;Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0005634;C:nucleus;IEA:UniProtKB-SubCell. |
GO-F |
GO:0003677;F:DNA binding;IEA:UniProtKB-KW. GO:0008270;F:zinc ion binding;IEA:InterPro. |
GO-P |
GO:0006355;P:regulation of transcription, DNA-dependent;IEA:UniProtKB-KW. GO:0006351;P:transcription, DNA-dependent;IEA:UniProtKB-KW. |