Protein basic information
LiverAtlas Protein ID |
HuLPr49433 |
Uniprot ID |
|
Uniprot Acc |
Q19AV6; |
Protein name |
Zinc finger SWIM domain-containing protein 7 |
Comment |
FUNCTION:Involved in early stages of the homologous recombination repair (HRR) pathway of double-stranded DNA breaks arising during DNA replication or induced by DNA-damaging agents.||SUBUNIT:Interacts with RAD51L3.||SUBCELLULAR LOCATION:Nucleus (Probable).||SIMILARITY:Belongs to the SWS1 family.||SIMILARITY:Contains 1 SWIM-type zinc finger. |
Subcellular localization |
Nucleus(Probable). |
Gene name |
|
Protein sequence
|
MAVVLPAVVEELLSEMAAAVQESARIPDEYLLSLKFLFGS SATQALDLVDRQSITLISSPSGRRVYQVLGSSSKTYTCL ASCHYCSCPAFAFSVLRKSDSILCKHLLAVYLSQVMRTC QQLSVSDKQLTDILLMEKKQEA |
Database cross reference |
RefSeq Protein accession:NP_001036162
|
Ontology annotation
GO-C |
GO:0005634;C:nucleus;IEA:UniProtKB-SubCell. |
GO-F |
GO:0008270;F:zinc ion binding;IEA:InterPro. |
GO-P |
GO:0006310;P:DNA recombination;IEA:UniProtKB-KW. GO:0006281;P:DNA repair;IEA:UniProtKB-KW. |